
- Synthetic Flavours & Fragrances
- Catalyst and Auxiliary
- Agrochemicals
- Organic Chemicals
- Materials
- Basic Inorganic Chemicals
- Pharmaceutical
- Plant Extract
- Reagent
- Dyestuff and Pigment
- Food Additives
- Others



GALANIN, RAT CAS114547-31-8 CAS NO.114547-31-8
- FOB Price: USD: 7.00-9.00 /Kilogram Get Latest Price
- Min.Order: 1 Kilogram
- Payment Terms: T/T,Other
- Available Specifications:
一(1-300)Kilogram一(300-500)Kilogram一(500-1000)Kilogram
- Product Details
Keywords
- GALANIN, RAT
- GLY-TRP-THR-LEU-ASN-SER-ALA-GLY-TYR-LEU-LEU-GLY-PRO-HIS-ALA-ILE-ASP-ASN-HIS-ARG-SER-PHE-SER-ASP-LYS-HIS-GLY-LEU-THR-NH2
- GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2
Quick Details
- ProName: GALANIN, RAT CAS114547-31-8
- CasNo: 114547-31-8
- Molecular Formula: C141H211N43O41
- Appearance: White powder
- Application: For scientific research
- DeliveryTime: 3-7Days
- PackAge: fiber can
- Port: Tianjin Xingang/Qingdao Port
- ProductionCapacity: 100 Metric Ton/Month
- Purity: 98%
- Storage: Seal and store in a cool and dry place
- Transportation: By sea/air/land
- LimitNum: 1 Kilogram
Superiority
1. Product advantages
♦ High purity, all above 98.5%, no impurities after dissolution
♦ We will test each batch to ensure quality
♦ OEM and private brand services designed for free
♦ Various cap colors available
♦ We can also provide MT1 peptide powder
2. Factory advantages
♦ Professional research team
♦ More than 5 doctors in high-tech R&D laboratories
♦ More than 1000 m2 of factory production line to ensure stable supply
♦ More than 1200 factories to manufacture products and control quality
3. Service advantages
♦ 24-hour online service
♦ Track package information and update it for customers
♦ Professional sales team
♦ Accept small order service
♦ Redelivery service if detained by customs
Details
Molecular formula C141H211N43O41
Molecular weight 3164.45,000
Accurate mass 3162.57000
PSA 1347.03000
Appearance properties white freeze-dried powder
Package
Delivery
Our company has long-term cooperation with many world-famous logistics companies to ensure transportation efficiency and cargo safety.
By Express |
By air |
By Sea |
Suitable for under 50kg |
Suitable for more than 50kg |
Suitable for more than 500kg |